- ITPA Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88296
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- ITPA
- Human
- C20orf37, DEE35, HLC14-06-P, ITPase, My049, NTPase, dJ794I6.3
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: GFEDKSAYAL CTFALSTGDP SQPVRLFRGR TSGRIVAPRG CQDFGWDPCF QPDGYEQTYA EMPKAEKNAV SHRFRALLEL QEYFGSLAA
- inosine triphosphatase
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA
Specifications/Features
Available conjugates: Unconjugated